PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000149102
Common NameMYB30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 342aa    MW: 38036.9 Da    PI: 8.8368
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000149102genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.78.5e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv ++++ G+g+W++++   g++R+ k+c++rw +yl
    MDP0000149102 14 KGPWTPEEDIILVSYIQERGPGNWRAVPTNTGLHRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding49.11.3e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T +E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
    MDP0000149102  67 RGNFTDQEEKMIIHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.6E-23564IPR009057Homeodomain-like
PROSITE profilePS5129425.064965IPR017930Myb domain
SuperFamilySSF466895.24E-3011108IPR009057Homeodomain-like
SMARTSM007171.4E-121363IPR001005SANT/Myb domain
PfamPF002492.2E-141461IPR001005SANT/Myb domain
CDDcd001671.07E-91661No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2465116IPR009057Homeodomain-like
SMARTSM007172.4E-1566114IPR001005SANT/Myb domain
PROSITE profilePS5129420.07166116IPR017930Myb domain
PfamPF002491.2E-1467112IPR001005SANT/Myb domain
CDDcd001673.37E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MGRPPCCXKE GVKKGPWTPE EDIILVSYIQ ERGPGNWRAV PTNTGLHRCS KSCRLRWTNY  60
LRPGIKRGNF TDQEEKMIIH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLRKKLSKLQ  120
AAGGGTEGLH SKDQGLNSNS SSQPISRGQW ERRLQTDIHM ARQALRDALS XEKPLTLSSD  180
LNPTDGFSIS SPKKPSLDQS SSSTYASSTE NISRLLKGWM KNPPKKSASF TNLANNKTDY  240
QHYSSSEGTT SVANTANSGN VELSDTFESL FGFESSNSYL SPSMSPEASL FQGESKPDLI  300
SDKLPLSFLE KWLFDESASP AALGKDHFFS DMLPDHGNAN FF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C9e-26141164105C-Myb DNA-Binding Domain
1msf_C9e-26141164105C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.302430.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008365400.10.0PREDICTED: myb-related protein 306-like
SwissprotP813921e-110MYB06_ANTMA; Myb-related protein 306
TrEMBLD9ZJ580.0D9ZJ58_MALDO; MYB domain class transcription factor
STRINGVIT_14s0108g00830.t011e-140(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101634115
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.11e-99myb domain protein 94